PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca39946.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 295aa    MW: 33345.5 Da    PI: 7.8097
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca39946.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM143.31.3e-44111382129
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 ppG+rFhPtdeel ++yLk+k+ gk+l+  ++++e+d+y++ Pw+Lp k ++k+++ +wyf ++r++ky++g r+nr t +g+Wk++g+d++v   +++
  Dca39946.1  11 PPGIRFHPTDEELFMYYLKRKLLGKSLRH-QIMSEIDVYQFAPWELPaKsCLKTRDLNWYFICPRSRKYPSGGRTNRGTVHGFWKSSGNDRTVNY-RNR 107
                 9*************************999.89**************95357778888*************************************9.899 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  vg  ktL+fy+g+ pkge+t+Wv+heyrle
  Dca39946.1 108 PVGKIKTLIFYRGKPPKGERTNWVIHEYRLE 138
                 *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-544160IPR003441NAC domain
PROSITE profilePS5100551.93310160IPR003441NAC domain
PfamPF023657.8E-2211137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDTALVSKSF PPGIRFHPTD EELFMYYLKR KLLGKSLRHQ IMSEIDVYQF APWELPAKSC  60
LKTRDLNWYF ICPRSRKYPS GGRTNRGTVH GFWKSSGNDR TVNYRNRPVG KIKTLIFYRG  120
KPPKGERTNW VIHEYRLEDK VLSEKGVALD SYVICKIFMK SGLGPKNGEN YGAPFMEEEW  180
DNSNDENVAS AQQQQQSVSV DIAGCSNGST ITSTLASPST LSTVQPYVAT TKGLPPIETE  240
EDELDRLLAK FTEECHNKPT PQSNVVDGLG NLAGRSSATS ANFDWSKFDW YDLCD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-46516012165NO APICAL MERISTEM PROTEIN
1ut4_B2e-46516012165NO APICAL MERISTEM PROTEIN
1ut7_A2e-46516012165NO APICAL MERISTEM PROTEIN
1ut7_B2e-46516012165NO APICAL MERISTEM PROTEIN
3swm_A2e-46516015168NAC domain-containing protein 19
3swm_B2e-46516015168NAC domain-containing protein 19
3swm_C2e-46516015168NAC domain-containing protein 19
3swm_D2e-46516015168NAC domain-containing protein 19
3swp_A2e-46516015168NAC domain-containing protein 19
3swp_B2e-46516015168NAC domain-containing protein 19
3swp_C2e-46516015168NAC domain-containing protein 19
3swp_D2e-46516015168NAC domain-containing protein 19
4dul_A2e-46516012165NAC domain-containing protein 19
4dul_B2e-46516012165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010674451.11e-106PREDICTED: NAC domain-containing protein 78-like
SwissprotQ9XIC51e-67NAC17_ARATH; NAC domain-containing protein 17
TrEMBLA0A0J8FE271e-106A0A0J8FE27_BETVU; Uncharacterized protein
STRINGVIT_04s0044g01220.t011e-80(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.12e-76NAC domain containing protein 103